-
Notifications
You must be signed in to change notification settings - Fork 2
FASTA sequences
touzet edited this page Dec 11, 2024
·
7 revisions
PAMPA processes amino-acid sequences. For that, it uses the standard FASTA format with UniprotKB-like header. The first line starts with a greater-than character (>) followed by some sequence identifier (SeqID), which is provided for informational purposes and can be customized by the user. Additionally, this line must contain three mandatory fields:
OS : scientific name of the organism
OX : taxonomic identifier of the organism, such as assigned by the NCBI (for example). This identifier should be the same as the one used in the taxonomy file.
GN : gene name
The other lines are the sequence representation, with one letter per amino acid.
For example:
>P02453 OS=Bos taurus OX=9913 GN=COL1A1
MFSFVDLRLLLLLAATALLTHGQEEGQEEGQEEDIPPVTCVQNGLRYHDRDVWKPVPCQI
CVCDNGNVLCDDVICDELKDCPNAKVPTDECCPVCPEGQESPTDQETTGVEGPKGDTGPR
GPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKSTGISVPGPM
GPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRP
GERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQM